Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6739.88 Da    PI: 10.5705
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien+ n qvtfskRr+g++KKA+ELS+LCda++ vi+f +tg+ly++ss  9 KRIENEANLQVTFSKRRAGMFKKAKELSILCDAQIGVIVFTNTGQLYDFSS 59
                                  79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.44E-24160IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.684160IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-25323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656060.12e-26PREDICTED: MADS-box transcription factor 23-like
SwissprotA2RVQ58e-25AGL16_ARATH; Agamous-like MADS-box protein AGL16
SwissprotQ9SI388e-25ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLJ3MDX66e-28J3MDX6_ORYBR; Uncharacterized protein
STRINGOB06G22200.12e-27(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.15e-26AGAMOUS-like 44